PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma13g00160.1
Common NameZOSMA_13G00160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MYB
Protein Properties Length: 996aa    MW: 110807 Da    PI: 5.7869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma13g00160.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-163682148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT++Ed  l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
  Zosma13g00160.1 36 KGQWTADEDSMLSEAVQTYKGKNWKKIAECFS-DRTDVQCLHRWQKVL 82
                     799*****************************.************986 PP

2Myb_DNA-binding49.88e-1688134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+ +++ v + G + W++Ia+ ++ gR +kqc++rw++ l
  Zosma13g00160.1  88 KGPWSKEEDDMIIEMVSKVGAKKWTLIAQALP-GRIGKQCRERWHNNL 134
                      79******************************.************975 PP

3Myb_DNA-binding47.73.6e-15140182145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r++WT+eE+  l++a++ +G++ W+   + ++ gRt++ +k++w+
  Zosma13g00160.1 140 RQAWTQEEEMALIQAHQIYGNK-WAELTNILP-GRTDNAIKNHWN 182
                      89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6843182IPR017930Myb domain
SMARTSM007173.0E-143584IPR001005SANT/Myb domain
PfamPF002494.5E-143682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-213794IPR009057Homeodomain-like
SuperFamilySSF466891.94E-1737101IPR009057Homeodomain-like
CDDcd001671.47E-123982No hitNo description
PROSITE profilePS5129429.51383138IPR017930Myb domain
SuperFamilySSF466897.86E-3085181IPR009057Homeodomain-like
SMARTSM007174.4E-1687136IPR001005SANT/Myb domain
CDDcd001677.23E-1490134No hitNo description
PfamPF139211.3E-1591151No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2595141IPR009057Homeodomain-like
PROSITE profilePS5129419.032139189IPR017930Myb domain
SMARTSM007172.8E-14139187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-20142189IPR009057Homeodomain-like
CDDcd001676.16E-11142182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 996 aa     Download sequence    Send to blast
MAGDRVRSST DATNDRPSKL KPPHGRTTGP TRRSAKGQWT ADEDSMLSEA VQTYKGKNWK  60
KIAECFSDRT DVQCLHRWQK VLNPELVKGP WSKEEDDMII EMVSKVGAKK WTLIAQALPG  120
RIGKQCRERW HNNLNPTINR QAWTQEEEMA LIQAHQIYGN KWAELTNILP GRTDNAIKNH  180
WNSSVKKKLD FYMSSGLLAQ FQGLPHAENP SHCKSSSSDG KKKGGSKSDV KDVVEVVESS  240
GHTQPPVHSV ETICIHENGH SSDQKTAHDL NFTCLEEYNN STEYAEHVFP HTQEIGVCVD  300
NSNQNLYVEN ALSGPPEGSV SSFMEESQRS SNLLQMPEHC QISDSNHGNE ELCPVSSRGF  360
NIHASLDKND SSTDKQIGLE FTEIDFSCNN HAGSAMFDVF SLSDSVAASS FIGTEPNANS  420
TICNTGTQNS ETNNMVDSTL QSNHPVCSSD MLCIPCSDGL DPNPSSFIYS GNGKVVFPNN  480
FDGGNALVQA QDSEFTTCMQ AELFDLLDSM VPSSDNCNVD LHLQTSKTPK KEIQISKDTK  540
TIEHYAYQEN SSGGLDHLNS ESLCYEPPRF PSVDFPFVTC DLISSADLQQ AYSPLGIRQL  600
TMPSYNHSLW DTSSKEGSPD IFLRNAAKSF LHTPSILKKR QRELLSPLRE KCDKKSEKSL  660
NQDLLCISLS NRNVSSSNKD ITCIEGETCD GYYTSNIKTF SPCHQKRKYV HVCPSELKES  720
SGHVQKECQD QAILNNGKSF KGLSDSDLQS NGVVSDHDMS NKTNTDRTGS ILVEHEINNR  780
WLFSPASDDP AENTKKKSID ERKQCPDVPL KSSGSFIEKI NSSIDSDFEK LNIYDDTPGI  840
KRNIESPSAW KSPWLLINDG FPLGKRITAS AAFEEFAYLL GSHGNDDNNS FDAIGLMRHL  900
SEHNVVSLTG DHEILRGVNS TKSHSNDVSS RPADSFTITN NHQLQNRDKE NFIHSLPNSM  960
MEGRVLDFSE CRTPSKENKF EVENIHHISP DSYKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C5e-62351895159MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-62351895159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9Q0310.0A0A0K9Q031_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.27e-98myb domain protein 3r-4